PTM Viewer PTM Viewer

AT1G70540.1

Arabidopsis thaliana [ath]

Plant invertase/pectin methylesterase inhibitor superfamily protein

No PTMs currently found

PLAZA: AT1G70540
Gene Family: HOM05D008070
Other Names: embryo sac development arrest 24; EDA24

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 167

MSTNLHLATAVILLLLTASQSGVAMAQRVMGGGRDPCSVSDFKVLCRSVVKGQKNVNAATEVSIRELMKRTIKAKEAAKISRKSGGGLKTCYSNYDSALENLQKALKNIKQNDGFSLNINLSASLTDFDTCNDAMGGGTASNVFAKSTSTLHEMADNCLALSTLVKQ

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR006501 28 163
Molecule Processing
Show Type From To
Signal Peptide 1 26

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here